Neuroendocrine control of puberty in vertebrates: Characterization of the Kisspeptin system in flatfish

Neuroendocrine control of puberty in vertebrates: Characterization of the Kisspeptin system in flatfish

Memoria de tesis doctoral presentada por Alejandro S. Mechaly para optar al grado de Doctor por la Universitat Pompeu Fabra (UPF), realizada bajo la dirección del Dr. Francesc Piferrer Circuns del Institut de Ciències del Mar (ICM-CSIC) y del Dr. Jordi Viñas de Puig de la Universitat de Girona (UdG).-- 164 pages

Saved in:
Bibliographic Details
Main Author: Mechaly, Alejandro S.
Other Authors: Piferrer, Francesc
Format: tesis doctoral biblioteca
Published: Universitat Pompeu Fabra 2011
Online Access:http://hdl.handle.net/10261/100873
Tags: Add Tag
No Tags, Be the first to tag this record!
id dig-icm-es-10261-100873
record_format koha
spelling dig-icm-es-10261-1008732018-12-21T11:45:08Z Neuroendocrine control of puberty in vertebrates: Characterization of the Kisspeptin system in flatfish Mechaly, Alejandro S. Piferrer, Francesc Viñas, Jordi Memoria de tesis doctoral presentada por Alejandro S. Mechaly para optar al grado de Doctor por la Universitat Pompeu Fabra (UPF), realizada bajo la dirección del Dr. Francesc Piferrer Circuns del Institut de Ciències del Mar (ICM-CSIC) y del Dr. Jordi Viñas de Puig de la Universitat de Girona (UdG).-- 164 pages [EN] The recently discovered decapeptide kisspeptin and its G-protein coupled receptor form a signaling system expressed ubiquitously and are implicated in a variety of still poorly characterized functions. In the brain, kisspeptin is secreted by specific neurons and its receptor is localized in GnRH neurons. Kisspeptin signaling has been fully established in the control of the onset of puberty in vertebrates, from fish to mammals. In this study, we characterized the kisspeptin gene in the Senegalese sole and characterized the kisspeptin receptor genes in both the Senegalese sole and in the Atlantic halibut. In contrast to other fish species, the two species analyzed here showed only the presence of one ligand and one receptor, probably as a consequence of the genome reduction characteristic of Pleuronectiformes. However, in both cases we found an alternative splicing mechanism based on intron retention that produces also non-functional isoforms, but whether this is part of a mechanism to control abundance of the active gene product is still not known. We document spatial and temporal changes of expression of kisspeptin and its receptor in the brain, pituitary and gonads related to the annual reproductive cycle. Finally, we present the first evidence of a possible link between energy balance and reproduction mediated by kisspeptin signaling in a non-mammalian vertebrate [CAT] El recentment descobert decapèptid kisspeptina i el seu receptor associat a una proteïna G formen un sistema que s’expressa ubiqüitament i que està implicat en diverses funcions, moltes de les quals encara no estan ben caracteritzades. En el cervell, la kisspeptina és secretada per neurones específiques, mentre que el seu receptor es troba a les neurones GnRH. Aquest sistema s’ha relacionat amb el control de l’inici de la pubertat en diferents vertebrats, des de peixos fins a mamífers. En aquest estudi, hem caracteritzat el gen de la kisspeptina en el llenguado senegalès, i els gens del receptor de la kisspeptina tant a llenguado senegalès com en l’Halibut de l’Atlàntic. Al contrari del que ocorre en moltes altres espècies de peixos, aquestes dues espècies només presenten un gen pel lligand i un gen pel receptor. Aquest fet és probable que estigui relacionat amb la reducció de la mida del genoma que han sofert els Pleuronectiformes. Tot i així, en les dues espècies s’hi troba un mecanisme d’empalmament alternatiu conseqüència d’una retenció intrónica que produeix una isoforma no funcional. Ara bé, si aquest mecanisme està relacionat amb el control de l’abundància dels trànscrits de la isoforma funcional encara està per esbrinar. Per altra banda, hem trobat canvis en l’expressió gènica tant en l’espai com en el temps durant un cicle reproductiu dels gens de la kisspeptina i el seu receptor en el cervell, pituïtària i gònades. Finalment, també presentem la primera evidència, en un vertebrat no mamífer, d’una possible relació entre el balanç energètic i la reproducció controlada pel sistema kisspeptina Peer Reviewed 2014-08-18T09:21:57Z 2014-08-18T09:21:57Z 2011 2014-08-18T09:21:57Z tesis doctoral http://purl.org/coar/resource_type/c_db06 http://hdl.handle.net/10261/100873 open Universitat Pompeu Fabra
institution ICM ES
collection DSpace
country España
countrycode ES
component Bibliográfico
access En linea
databasecode dig-icm-es
tag biblioteca
region Europa del Sur
libraryname Biblioteca del ICM España
description Memoria de tesis doctoral presentada por Alejandro S. Mechaly para optar al grado de Doctor por la Universitat Pompeu Fabra (UPF), realizada bajo la dirección del Dr. Francesc Piferrer Circuns del Institut de Ciències del Mar (ICM-CSIC) y del Dr. Jordi Viñas de Puig de la Universitat de Girona (UdG).-- 164 pages
author2 Piferrer, Francesc
author_facet Piferrer, Francesc
Mechaly, Alejandro S.
format tesis doctoral
author Mechaly, Alejandro S.
spellingShingle Mechaly, Alejandro S.
Neuroendocrine control of puberty in vertebrates: Characterization of the Kisspeptin system in flatfish
author_sort Mechaly, Alejandro S.
title Neuroendocrine control of puberty in vertebrates: Characterization of the Kisspeptin system in flatfish
title_short Neuroendocrine control of puberty in vertebrates: Characterization of the Kisspeptin system in flatfish
title_full Neuroendocrine control of puberty in vertebrates: Characterization of the Kisspeptin system in flatfish
title_fullStr Neuroendocrine control of puberty in vertebrates: Characterization of the Kisspeptin system in flatfish
title_full_unstemmed Neuroendocrine control of puberty in vertebrates: Characterization of the Kisspeptin system in flatfish
title_sort neuroendocrine control of puberty in vertebrates: characterization of the kisspeptin system in flatfish
publisher Universitat Pompeu Fabra
publishDate 2011
url http://hdl.handle.net/10261/100873
work_keys_str_mv AT mechalyalejandros neuroendocrinecontrolofpubertyinvertebratescharacterizationofthekisspeptinsysteminflatfish
_version_ 1777666187421810688

Similar Items