Structural characterisation of the acyl CoA Diacylglycerol acyltransferase 1 (DGAT1) gene and association studies with milk traits in Assaf sheep breed

Because DGAT1 plays a fundamental role in triacylglycerol synthesis, existing SNPs in DGAT1 gene might provide important information in partially explaining, the variation of milk fat content in dairy sheep. Therefore, the main objective of this study was to sequence the complete ovine acyl CoAdiacylglycerol acyltransferase 1 (DGAT1)gene in order to identify polymorphisms and to look for its possible association with milk traits in Assaf sheep breed. Polymorphisms identification in the DGAT1gene was carried out in 50 individuals belonging to five sheep breeds reared in Spain Rasa Aragonesa (n=10), Manchega (n=10), Churra Tensina (n=10), Latxa (n=10) and Spanish Assaf (n=10). The association studies between polymorphisms, and milk traits were carried out using animals belonging to three flocks of Assaf breed (n=402). Four SNPs were detected, one in exon 1 (EU178818 g.358C>A), two in exon 17 (g.8522C>T and g.8539C>T), and one in intron 10 (g.7457C>A). The SNP in exon 1, g.358C>A, generates a non-conservative substitution at position p. Asp53Glu (GenBank ABW24130). The first SNP in exon 17 (g.8522C>T)causes an amino acid change at position p. Arg482Cys. The genotype frequencies were studied in a panel of 9 breed reared in Spain Ansotana (n=50), Latxa (n=36), Romanov (n=33), Rasa aragonesa (n=55), Churra (n=52), Churra tensina (n=57), Churra lebrijana (n=50), Manchega (n=48) and Assaf (n=402). All breeds were in Hardy-Weinberg equilibrium for all SNPs, except for the SNPs g.8522C>T and g.8539C>T SNPs which showed a deficit of heterozygous animals in Ansotana breed. This gene show low variability in a panel of 9 breeds reared in Spain. The only polymorphism not fixed in Assaf breed was the SNP g.8539C>T, and was used to test possible association with milk traits. The allelic frequency of the 8539C allele was 0.96, being 373 animals homozygous for the CC genotype and 29 heterozygous. The association studies showed that lactose, fatty acids C40, C161 c9, and the ratio n-6n-3 were affected by the SNP g.8539C>T. Animals carrying the CC genotype had greater lactose, C4:0 and C16:1 c9 contents and lower ratio of n-6:n-3 compare to the CT ones. Probably the SNP g.8539C>T, is not causative of the variation observed in the lactose content but might be in linkage disequilibrium with the causal mutation located in the same or other closer gene. © 2015 Elsevier B.V. All rights reserved.

Saved in:
Bibliographic Details
Main Authors: Dervishi, E., Serrano, M., Joy, M., Sarto, P., Somera, A., González-Calvo, L., Berzal-Herranz, B., Molino, F., Martínez-Royo, A., Calvo, J. H.
Format: journal article biblioteca
Language:eng
Published: 2015
Online Access:http://hdl.handle.net/20.500.12792/1054
Tags: Add Tag
No Tags, Be the first to tag this record!
id dig-inia-es-20.500.12792-1054
record_format koha
spelling dig-inia-es-20.500.12792-10542020-12-15T09:14:59Z Structural characterisation of the acyl CoA Diacylglycerol acyltransferase 1 (DGAT1) gene and association studies with milk traits in Assaf sheep breed Dervishi, E. Serrano, M. Joy, M. Sarto, P. Somera, A. González-Calvo, L. Berzal-Herranz, B. Molino, F. Martínez-Royo, A. Calvo, J. H. Because DGAT1 plays a fundamental role in triacylglycerol synthesis, existing SNPs in DGAT1 gene might provide important information in partially explaining, the variation of milk fat content in dairy sheep. Therefore, the main objective of this study was to sequence the complete ovine acyl CoAdiacylglycerol acyltransferase 1 (DGAT1)gene in order to identify polymorphisms and to look for its possible association with milk traits in Assaf sheep breed. Polymorphisms identification in the DGAT1gene was carried out in 50 individuals belonging to five sheep breeds reared in Spain Rasa Aragonesa (n=10), Manchega (n=10), Churra Tensina (n=10), Latxa (n=10) and Spanish Assaf (n=10). The association studies between polymorphisms, and milk traits were carried out using animals belonging to three flocks of Assaf breed (n=402). Four SNPs were detected, one in exon 1 (EU178818 g.358C>A), two in exon 17 (g.8522C>T and g.8539C>T), and one in intron 10 (g.7457C>A). The SNP in exon 1, g.358C>A, generates a non-conservative substitution at position p. Asp53Glu (GenBank ABW24130). The first SNP in exon 17 (g.8522C>T)causes an amino acid change at position p. Arg482Cys. The genotype frequencies were studied in a panel of 9 breed reared in Spain Ansotana (n=50), Latxa (n=36), Romanov (n=33), Rasa aragonesa (n=55), Churra (n=52), Churra tensina (n=57), Churra lebrijana (n=50), Manchega (n=48) and Assaf (n=402). All breeds were in Hardy-Weinberg equilibrium for all SNPs, except for the SNPs g.8522C>T and g.8539C>T SNPs which showed a deficit of heterozygous animals in Ansotana breed. This gene show low variability in a panel of 9 breeds reared in Spain. The only polymorphism not fixed in Assaf breed was the SNP g.8539C>T, and was used to test possible association with milk traits. The allelic frequency of the 8539C allele was 0.96, being 373 animals homozygous for the CC genotype and 29 heterozygous. The association studies showed that lactose, fatty acids C40, C161 c9, and the ratio n-6n-3 were affected by the SNP g.8539C>T. Animals carrying the CC genotype had greater lactose, C4:0 and C16:1 c9 contents and lower ratio of n-6:n-3 compare to the CT ones. Probably the SNP g.8539C>T, is not causative of the variation observed in the lactose content but might be in linkage disequilibrium with the causal mutation located in the same or other closer gene. © 2015 Elsevier B.V. All rights reserved. 2020-10-22T11:43:58Z 2020-10-22T11:43:58Z 2015 journal article http://hdl.handle.net/20.500.12792/1054 10.1016/j.smallrumres.2015.08.015 eng Attribution-NonCommercial-ShareAlike 4.0 International http://creativecommons.org/licenses/by-nc-sa/4.0/ open access
institution INIA ES
collection DSpace
country España
countrycode ES
component Bibliográfico
access En linea
databasecode dig-inia-es
tag biblioteca
region Europa del Sur
libraryname Biblioteca del INIA España
language eng
description Because DGAT1 plays a fundamental role in triacylglycerol synthesis, existing SNPs in DGAT1 gene might provide important information in partially explaining, the variation of milk fat content in dairy sheep. Therefore, the main objective of this study was to sequence the complete ovine acyl CoAdiacylglycerol acyltransferase 1 (DGAT1)gene in order to identify polymorphisms and to look for its possible association with milk traits in Assaf sheep breed. Polymorphisms identification in the DGAT1gene was carried out in 50 individuals belonging to five sheep breeds reared in Spain Rasa Aragonesa (n=10), Manchega (n=10), Churra Tensina (n=10), Latxa (n=10) and Spanish Assaf (n=10). The association studies between polymorphisms, and milk traits were carried out using animals belonging to three flocks of Assaf breed (n=402). Four SNPs were detected, one in exon 1 (EU178818 g.358C>A), two in exon 17 (g.8522C>T and g.8539C>T), and one in intron 10 (g.7457C>A). The SNP in exon 1, g.358C>A, generates a non-conservative substitution at position p. Asp53Glu (GenBank ABW24130). The first SNP in exon 17 (g.8522C>T)causes an amino acid change at position p. Arg482Cys. The genotype frequencies were studied in a panel of 9 breed reared in Spain Ansotana (n=50), Latxa (n=36), Romanov (n=33), Rasa aragonesa (n=55), Churra (n=52), Churra tensina (n=57), Churra lebrijana (n=50), Manchega (n=48) and Assaf (n=402). All breeds were in Hardy-Weinberg equilibrium for all SNPs, except for the SNPs g.8522C>T and g.8539C>T SNPs which showed a deficit of heterozygous animals in Ansotana breed. This gene show low variability in a panel of 9 breeds reared in Spain. The only polymorphism not fixed in Assaf breed was the SNP g.8539C>T, and was used to test possible association with milk traits. The allelic frequency of the 8539C allele was 0.96, being 373 animals homozygous for the CC genotype and 29 heterozygous. The association studies showed that lactose, fatty acids C40, C161 c9, and the ratio n-6n-3 were affected by the SNP g.8539C>T. Animals carrying the CC genotype had greater lactose, C4:0 and C16:1 c9 contents and lower ratio of n-6:n-3 compare to the CT ones. Probably the SNP g.8539C>T, is not causative of the variation observed in the lactose content but might be in linkage disequilibrium with the causal mutation located in the same or other closer gene. © 2015 Elsevier B.V. All rights reserved.
format journal article
author Dervishi, E.
Serrano, M.
Joy, M.
Sarto, P.
Somera, A.
González-Calvo, L.
Berzal-Herranz, B.
Molino, F.
Martínez-Royo, A.
Calvo, J. H.
spellingShingle Dervishi, E.
Serrano, M.
Joy, M.
Sarto, P.
Somera, A.
González-Calvo, L.
Berzal-Herranz, B.
Molino, F.
Martínez-Royo, A.
Calvo, J. H.
Structural characterisation of the acyl CoA Diacylglycerol acyltransferase 1 (DGAT1) gene and association studies with milk traits in Assaf sheep breed
author_facet Dervishi, E.
Serrano, M.
Joy, M.
Sarto, P.
Somera, A.
González-Calvo, L.
Berzal-Herranz, B.
Molino, F.
Martínez-Royo, A.
Calvo, J. H.
author_sort Dervishi, E.
title Structural characterisation of the acyl CoA Diacylglycerol acyltransferase 1 (DGAT1) gene and association studies with milk traits in Assaf sheep breed
title_short Structural characterisation of the acyl CoA Diacylglycerol acyltransferase 1 (DGAT1) gene and association studies with milk traits in Assaf sheep breed
title_full Structural characterisation of the acyl CoA Diacylglycerol acyltransferase 1 (DGAT1) gene and association studies with milk traits in Assaf sheep breed
title_fullStr Structural characterisation of the acyl CoA Diacylglycerol acyltransferase 1 (DGAT1) gene and association studies with milk traits in Assaf sheep breed
title_full_unstemmed Structural characterisation of the acyl CoA Diacylglycerol acyltransferase 1 (DGAT1) gene and association studies with milk traits in Assaf sheep breed
title_sort structural characterisation of the acyl coa diacylglycerol acyltransferase 1 (dgat1) gene and association studies with milk traits in assaf sheep breed
publishDate 2015
url http://hdl.handle.net/20.500.12792/1054
work_keys_str_mv AT dervishie structuralcharacterisationoftheacylcoadiacylglycerolacyltransferase1dgat1geneandassociationstudieswithmilktraitsinassafsheepbreed
AT serranom structuralcharacterisationoftheacylcoadiacylglycerolacyltransferase1dgat1geneandassociationstudieswithmilktraitsinassafsheepbreed
AT joym structuralcharacterisationoftheacylcoadiacylglycerolacyltransferase1dgat1geneandassociationstudieswithmilktraitsinassafsheepbreed
AT sartop structuralcharacterisationoftheacylcoadiacylglycerolacyltransferase1dgat1geneandassociationstudieswithmilktraitsinassafsheepbreed
AT someraa structuralcharacterisationoftheacylcoadiacylglycerolacyltransferase1dgat1geneandassociationstudieswithmilktraitsinassafsheepbreed
AT gonzalezcalvol structuralcharacterisationoftheacylcoadiacylglycerolacyltransferase1dgat1geneandassociationstudieswithmilktraitsinassafsheepbreed
AT berzalherranzb structuralcharacterisationoftheacylcoadiacylglycerolacyltransferase1dgat1geneandassociationstudieswithmilktraitsinassafsheepbreed
AT molinof structuralcharacterisationoftheacylcoadiacylglycerolacyltransferase1dgat1geneandassociationstudieswithmilktraitsinassafsheepbreed
AT martinezroyoa structuralcharacterisationoftheacylcoadiacylglycerolacyltransferase1dgat1geneandassociationstudieswithmilktraitsinassafsheepbreed
AT calvojh structuralcharacterisationoftheacylcoadiacylglycerolacyltransferase1dgat1geneandassociationstudieswithmilktraitsinassafsheepbreed
_version_ 1758004955474558976