Structural and functional characterisation of the αS1-casein (CSN1S1) gene and association studies with milk traits in Assaf sheep breed

Genetic polymorphisms in genes encoding milk proteins are of interest to the animal breeding and dairy industry due to their effects on production traits, milk composition and milk quality. For this purpose, the total length of the CSN1S1 gene has been sequenced and characterised in Assaf animals with an extreme phenotype for milk protein content. In the present study, some of the polymorphisms were genotyped for association analysis studies with milk protein content in a population of 444 Assaf ewes. Furthermore, the influences of these polymorphisms on the transcription rate of this gene were also evaluated in 45 Churra Tensina ewes. An 18427-bp DNA-sequence of the CSN1S1 gene, including the entire CDS, 5'- and 3'UTR regions, and the promoter region, was analysed, leading to the identification of 61 polymorphisms. Two polymorphisms detected in the 5' flanking region were located within possible trans-acting factor binding sites, modifying the putative CdxA and GATA-1 consensus sites. The SNP (JN560175 g.1123C>A) that modifies a putative CdxA consensus site showed a significant effect on the expression of the CSN1S1 gene (P=0.043), but no effect was found for protein content. A SNP in exon 17 (g.16101C>T) produces a non-conservative substitution of isoleucine to threonine at position 209 in the pre-protein (GenBank accession no. JN560175), but no significant associations with milk protein content were found. Finally, two SNPs located in exons 18 (g.16721C>A) and 19 (g.17826G>A) modify a putative target site for two bovine miRNA (bta-miR-631 and bta-miR-1224, respectively). Only the SNP in exon 18 showed a lightly significant additive genetic effect (P<0.1), with protein content for the CC genotype (4.43%) that accounts for 2.37% of the population mean (4.33%) for this trait. The results of the association and expression studies in exon 18 (g.16721C>A) were consistent, as the expression of the CSN1S1 gene in animals with the CC genotype was approximately 1.8 times greater than the expression of the GG genotype. Further studies concerning cheese yield and casein content as well as functional studies of transcription factors and miRNA binding activity are needed to elucidate the function of these SNPs and their application to breeding schemes. © 2013 Elsevier B.V.

Saved in:
Bibliographic Details
Main Authors: Calvo, J. H., Dervishi, E., Sarto, P., González-Calvo, L., Berzal-Herranz, B., Molino, F., Serrano Noreña, Magdalena, Joy, M.
Format: journal article biblioteca
Language:English
Published: Elsevier 2013
Subjects:Sheep, Milk, CSN1S1, Polymorphism, Functional,
Online Access:http://hdl.handle.net/20.500.12792/5581
http://hdl.handle.net/10261/293470
Tags: Add Tag
No Tags, Be the first to tag this record!
id dig-inia-es-10261-293470
record_format koha
spelling dig-inia-es-10261-2934702023-02-20T10:28:50Z Structural and functional characterisation of the αS1-casein (CSN1S1) gene and association studies with milk traits in Assaf sheep breed Calvo, J. H. Dervishi, E. Sarto, P. González-Calvo, L. Berzal-Herranz, B. Molino, F. Serrano Noreña, Magdalena Joy, M. Sheep Milk CSN1S1 Polymorphism Functional Genetic polymorphisms in genes encoding milk proteins are of interest to the animal breeding and dairy industry due to their effects on production traits, milk composition and milk quality. For this purpose, the total length of the CSN1S1 gene has been sequenced and characterised in Assaf animals with an extreme phenotype for milk protein content. In the present study, some of the polymorphisms were genotyped for association analysis studies with milk protein content in a population of 444 Assaf ewes. Furthermore, the influences of these polymorphisms on the transcription rate of this gene were also evaluated in 45 Churra Tensina ewes. An 18427-bp DNA-sequence of the CSN1S1 gene, including the entire CDS, 5'- and 3'UTR regions, and the promoter region, was analysed, leading to the identification of 61 polymorphisms. Two polymorphisms detected in the 5' flanking region were located within possible trans-acting factor binding sites, modifying the putative CdxA and GATA-1 consensus sites. The SNP (JN560175 g.1123C>A) that modifies a putative CdxA consensus site showed a significant effect on the expression of the CSN1S1 gene (P=0.043), but no effect was found for protein content. A SNP in exon 17 (g.16101C>T) produces a non-conservative substitution of isoleucine to threonine at position 209 in the pre-protein (GenBank accession no. JN560175), but no significant associations with milk protein content were found. Finally, two SNPs located in exons 18 (g.16721C>A) and 19 (g.17826G>A) modify a putative target site for two bovine miRNA (bta-miR-631 and bta-miR-1224, respectively). Only the SNP in exon 18 showed a lightly significant additive genetic effect (P<0.1), with protein content for the CC genotype (4.43%) that accounts for 2.37% of the population mean (4.33%) for this trait. The results of the association and expression studies in exon 18 (g.16721C>A) were consistent, as the expression of the CSN1S1 gene in animals with the CC genotype was approximately 1.8 times greater than the expression of the GG genotype. Further studies concerning cheese yield and casein content as well as functional studies of transcription factors and miRNA binding activity are needed to elucidate the function of these SNPs and their application to breeding schemes. © 2013 Elsevier B.V. 2023-02-20T10:28:50Z 2023-02-20T10:28:50Z 2013 journal article Livestock Science 157(1): 1-8 (2013) 1871-1413 http://hdl.handle.net/20.500.12792/5581 http://hdl.handle.net/10261/293470 10.1016/j.livsci.2013.06.014 en none Elsevier
institution INIA ES
collection DSpace
country España
countrycode ES
component Bibliográfico
access En linea
databasecode dig-inia-es
tag biblioteca
region Europa del Sur
libraryname Biblioteca del INIA España
language English
topic Sheep
Milk
CSN1S1
Polymorphism
Functional
Sheep
Milk
CSN1S1
Polymorphism
Functional
spellingShingle Sheep
Milk
CSN1S1
Polymorphism
Functional
Sheep
Milk
CSN1S1
Polymorphism
Functional
Calvo, J. H.
Dervishi, E.
Sarto, P.
González-Calvo, L.
Berzal-Herranz, B.
Molino, F.
Serrano Noreña, Magdalena
Joy, M.
Structural and functional characterisation of the αS1-casein (CSN1S1) gene and association studies with milk traits in Assaf sheep breed
description Genetic polymorphisms in genes encoding milk proteins are of interest to the animal breeding and dairy industry due to their effects on production traits, milk composition and milk quality. For this purpose, the total length of the CSN1S1 gene has been sequenced and characterised in Assaf animals with an extreme phenotype for milk protein content. In the present study, some of the polymorphisms were genotyped for association analysis studies with milk protein content in a population of 444 Assaf ewes. Furthermore, the influences of these polymorphisms on the transcription rate of this gene were also evaluated in 45 Churra Tensina ewes. An 18427-bp DNA-sequence of the CSN1S1 gene, including the entire CDS, 5'- and 3'UTR regions, and the promoter region, was analysed, leading to the identification of 61 polymorphisms. Two polymorphisms detected in the 5' flanking region were located within possible trans-acting factor binding sites, modifying the putative CdxA and GATA-1 consensus sites. The SNP (JN560175 g.1123C>A) that modifies a putative CdxA consensus site showed a significant effect on the expression of the CSN1S1 gene (P=0.043), but no effect was found for protein content. A SNP in exon 17 (g.16101C>T) produces a non-conservative substitution of isoleucine to threonine at position 209 in the pre-protein (GenBank accession no. JN560175), but no significant associations with milk protein content were found. Finally, two SNPs located in exons 18 (g.16721C>A) and 19 (g.17826G>A) modify a putative target site for two bovine miRNA (bta-miR-631 and bta-miR-1224, respectively). Only the SNP in exon 18 showed a lightly significant additive genetic effect (P<0.1), with protein content for the CC genotype (4.43%) that accounts for 2.37% of the population mean (4.33%) for this trait. The results of the association and expression studies in exon 18 (g.16721C>A) were consistent, as the expression of the CSN1S1 gene in animals with the CC genotype was approximately 1.8 times greater than the expression of the GG genotype. Further studies concerning cheese yield and casein content as well as functional studies of transcription factors and miRNA binding activity are needed to elucidate the function of these SNPs and their application to breeding schemes. © 2013 Elsevier B.V.
format journal article
topic_facet Sheep
Milk
CSN1S1
Polymorphism
Functional
author Calvo, J. H.
Dervishi, E.
Sarto, P.
González-Calvo, L.
Berzal-Herranz, B.
Molino, F.
Serrano Noreña, Magdalena
Joy, M.
author_facet Calvo, J. H.
Dervishi, E.
Sarto, P.
González-Calvo, L.
Berzal-Herranz, B.
Molino, F.
Serrano Noreña, Magdalena
Joy, M.
author_sort Calvo, J. H.
title Structural and functional characterisation of the αS1-casein (CSN1S1) gene and association studies with milk traits in Assaf sheep breed
title_short Structural and functional characterisation of the αS1-casein (CSN1S1) gene and association studies with milk traits in Assaf sheep breed
title_full Structural and functional characterisation of the αS1-casein (CSN1S1) gene and association studies with milk traits in Assaf sheep breed
title_fullStr Structural and functional characterisation of the αS1-casein (CSN1S1) gene and association studies with milk traits in Assaf sheep breed
title_full_unstemmed Structural and functional characterisation of the αS1-casein (CSN1S1) gene and association studies with milk traits in Assaf sheep breed
title_sort structural and functional characterisation of the αs1-casein (csn1s1) gene and association studies with milk traits in assaf sheep breed
publisher Elsevier
publishDate 2013
url http://hdl.handle.net/20.500.12792/5581
http://hdl.handle.net/10261/293470
work_keys_str_mv AT calvojh structuralandfunctionalcharacterisationoftheas1caseincsn1s1geneandassociationstudieswithmilktraitsinassafsheepbreed
AT dervishie structuralandfunctionalcharacterisationoftheas1caseincsn1s1geneandassociationstudieswithmilktraitsinassafsheepbreed
AT sartop structuralandfunctionalcharacterisationoftheas1caseincsn1s1geneandassociationstudieswithmilktraitsinassafsheepbreed
AT gonzalezcalvol structuralandfunctionalcharacterisationoftheas1caseincsn1s1geneandassociationstudieswithmilktraitsinassafsheepbreed
AT berzalherranzb structuralandfunctionalcharacterisationoftheas1caseincsn1s1geneandassociationstudieswithmilktraitsinassafsheepbreed
AT molinof structuralandfunctionalcharacterisationoftheas1caseincsn1s1geneandassociationstudieswithmilktraitsinassafsheepbreed
AT serranonorenamagdalena structuralandfunctionalcharacterisationoftheas1caseincsn1s1geneandassociationstudieswithmilktraitsinassafsheepbreed
AT joym structuralandfunctionalcharacterisationoftheas1caseincsn1s1geneandassociationstudieswithmilktraitsinassafsheepbreed
_version_ 1767603480401281024