Growth and survival of Penaeus monodon postlarvae fed shrimp head meal and fish meal as primary animal source of protein
Although shrimp head meal alone does not provide for good growth and survival, fish meal can provide high survival rate. The addition of shrimp head improves this diet. It is suggested that cholesterol present in shrimp could have caused this difference. Composition of the test diets is tabulated, as are proximate chemical analysis of the diets, and the mean initial weights, final weights, weight gains, survival rate, feed consumed, protein consumed, of Penaeus monodon postlarvae, feed conversion and protein efficiency ratio.
Saved in:
| Main Authors: | , |
|---|---|
| Format: | article biblioteca |
| Language: | English |
| Published: |
1978
|
| Subjects: | Aquaculture, Biology, Juveniles, Feed composition, Growth, Survival, Powdered products, Proteins, Crustacean culture, Penaeus monodon, Malacostraca, |
| Online Access: | http://hdl.handle.net/1834/34030 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| id |
dig-aquadocs-1834-34030 |
|---|---|
| record_format |
koha |
| spelling |
dig-aquadocs-1834-340302021-07-11T04:52:42Z Growth and survival of Penaeus monodon postlarvae fed shrimp head meal and fish meal as primary animal source of protein Piedad-Pascual, Felicitas Destajo, Warnita H. Aquaculture Biology Juveniles Feed composition Growth Survival Powdered products Proteins Crustacean culture Penaeus monodon Malacostraca Although shrimp head meal alone does not provide for good growth and survival, fish meal can provide high survival rate. The addition of shrimp head improves this diet. It is suggested that cholesterol present in shrimp could have caused this difference. Composition of the test diets is tabulated, as are proximate chemical analysis of the diets, and the mean initial weights, final weights, weight gains, survival rate, feed consumed, protein consumed, of Penaeus monodon postlarvae, feed conversion and protein efficiency ratio. 2021-06-24T17:33:52Z 2021-06-24T17:33:52Z 1978 article http://hdl.handle.net/1834/34030 en http://www.seafdec.org.ph http://repository.seafdec.org.ph application/pdf application/pdf 26-30 http://aquaticcommons.org/id/eprint/18682 17342 2015-11-11 17:48:35 18682 Southeast Asian Fisheries Development Center, Aquaculture Department |
| institution |
UNESCO |
| collection |
DSpace |
| country |
Francia |
| countrycode |
FR |
| component |
Bibliográfico |
| access |
En linea |
| databasecode |
dig-aquadocs |
| tag |
biblioteca |
| region |
Europa del Oeste |
| libraryname |
Repositorio AQUADOCS |
| language |
English |
| topic |
Aquaculture Biology Juveniles Feed composition Growth Survival Powdered products Proteins Crustacean culture Penaeus monodon Malacostraca Aquaculture Biology Juveniles Feed composition Growth Survival Powdered products Proteins Crustacean culture Penaeus monodon Malacostraca |
| spellingShingle |
Aquaculture Biology Juveniles Feed composition Growth Survival Powdered products Proteins Crustacean culture Penaeus monodon Malacostraca Aquaculture Biology Juveniles Feed composition Growth Survival Powdered products Proteins Crustacean culture Penaeus monodon Malacostraca Piedad-Pascual, Felicitas Destajo, Warnita H. Growth and survival of Penaeus monodon postlarvae fed shrimp head meal and fish meal as primary animal source of protein |
| description |
Although shrimp head meal alone does not provide for good growth and survival, fish meal can provide high survival rate. The addition of shrimp head improves this diet. It is suggested that cholesterol present in shrimp could have caused this difference. Composition of the test diets is tabulated, as are proximate chemical analysis of the diets, and the mean initial weights, final weights, weight gains, survival rate, feed consumed, protein consumed, of Penaeus monodon postlarvae, feed conversion and protein efficiency ratio. |
| format |
article |
| topic_facet |
Aquaculture Biology Juveniles Feed composition Growth Survival Powdered products Proteins Crustacean culture Penaeus monodon Malacostraca |
| author |
Piedad-Pascual, Felicitas Destajo, Warnita H. |
| author_facet |
Piedad-Pascual, Felicitas Destajo, Warnita H. |
| author_sort |
Piedad-Pascual, Felicitas |
| title |
Growth and survival of Penaeus monodon postlarvae fed shrimp head meal and fish meal as primary animal source of protein |
| title_short |
Growth and survival of Penaeus monodon postlarvae fed shrimp head meal and fish meal as primary animal source of protein |
| title_full |
Growth and survival of Penaeus monodon postlarvae fed shrimp head meal and fish meal as primary animal source of protein |
| title_fullStr |
Growth and survival of Penaeus monodon postlarvae fed shrimp head meal and fish meal as primary animal source of protein |
| title_full_unstemmed |
Growth and survival of Penaeus monodon postlarvae fed shrimp head meal and fish meal as primary animal source of protein |
| title_sort |
growth and survival of penaeus monodon postlarvae fed shrimp head meal and fish meal as primary animal source of protein |
| publishDate |
1978 |
| url |
http://hdl.handle.net/1834/34030 |
| work_keys_str_mv |
AT piedadpascualfelicitas growthandsurvivalofpenaeusmonodonpostlarvaefedshrimpheadmealandfishmealasprimaryanimalsourceofprotein AT destajowarnitah growthandsurvivalofpenaeusmonodonpostlarvaefedshrimpheadmealandfishmealasprimaryanimalsourceofprotein |
| _version_ |
1756079171027599360 |