Antimicrobial Activity of Cathelicidin-Derived Peptide from the Iberian Mole Talpa occidentalis
19 Pág. Centro de Biotecnología y Genómica de Plantas (CBGP)
Saved in:
| Main Authors: | , , , , , , |
|---|---|
| Other Authors: | |
| Format: | artículo biblioteca |
| Language: | English |
| Published: |
Multidisciplinary Digital Publishing Institute
2022-07-10
|
| Subjects: | Eulipotyphla, Talpidae, Antimicrobial peptide, Insectivores, Mammals, Innate immunity, |
| Online Access: | http://hdl.handle.net/10261/278521 http://dx.doi.org/10.13039/501100000780 http://dx.doi.org/10.13039/501100007757 |
| Tags: |
Add Tag
No Tags, Be the first to tag this record!
|
| id |
dig-inia-es-10261-278521 |
|---|---|
| record_format |
koha |
| spelling |
dig-inia-es-10261-2785212022-11-28T13:26:59Z Antimicrobial Activity of Cathelicidin-Derived Peptide from the Iberian Mole Talpa occidentalis Otazo-Pérez, Andrea Asensio-Calavia, Patricia González-Acosta, Sergio Baca-González, Victoria López, Manuel R. Morales-De la Nuez, Antonio Pérez de Lastra, José Manuel European Commission Agencia Canaria de Investigación, Innovación y Sociedad de la Información Caja Canarias Otazo-Pérez, Andrea [0000-0002-4437-3832] Asensio-Calavia, Patricia [0000-0001-8413-8426] González-Acosta, Sergio [0000-0002-6012-8255] Baca-González, Victoria [0000-0001-7195-7211] Morales-De la Nuez, Antonio [0000-0002-0184-2037] Pérez de la Lastra, José Manuel [0000-0003-4663-5565] Eulipotyphla Talpidae Antimicrobial peptide Insectivores Mammals Innate immunity 19 Pág. Centro de Biotecnología y Genómica de Plantas (CBGP) The immune systems of all vertebrates contain cathelicidins, a family of antimicrobial peptides. Cathelicidins are a type of innate immune effector that have a number of biological functions, including a well-known direct antibacterial action and immunomodulatory function. In search of new templates for antimicrobial peptide discovery, we have identified and characterized the cathelicidin of the small mammal Talpa occidentalis. We describe the heterogeneity of cathelicidin in the order Eulipotyphla in relation to the Iberian mole and predict its antibacterial activity using bioinformatics tools. In an effort to correlate these findings, we derived the putative active peptide and performed in vitro hemolysis and antimicrobial activity assays, confirming that Iberian mole cathelicidins are antimicrobial. Our results showed that the Iberian mole putative peptide, named To-KL37 (KLFGKVGNLLQKGWQKIKNIGRRIKDFFRNIRPMQEA) has antibacterial and antifungal activity. Understanding the antimicrobial defense of insectivores may help scientists prevent the spread of pathogens to humans. We hope that this study can also provide new, effective antibacterial peptides for future drug development. This research was funded by projects APOGEO (Cooperation Program INTERREG-MAC 2014–2020, with European Funds for Regional Development-FEDER, “Agencia Canaria de Investigación, Innovación y Sociedad de la Información (ACIISI) del Gobierno de Canarias”, Project ProID2020010134 “Bioprospección y biotecnología en el descubrimiento de péptidos antimicrobianos contra patógenos resistentes” and Caja Canarias, Project 2019SP43. The funders had no role in the design of the study; in the collection, analyses, or interpretation of data; in the writing of the manuscript, or in the decision to publish the results. Peer reviewed 2022-09-06T06:46:51Z 2022-09-06T06:46:51Z 2022-07-10 artículo Vaccines 10(7): 1105(2022) 2076-393X http://hdl.handle.net/10261/278521 10.3390/vaccines10071105 http://dx.doi.org/10.13039/501100000780 http://dx.doi.org/10.13039/501100007757 35891269 en #PLACEHOLDER_PARENT_METADATA_VALUE# info:eu-repo/grantAgreement/EC/ProID2020010134/ “Bioprospección y biotecnología en el descubrimiento de péptidos antimicrobianos contra patógenos resistentes” Vaccines Publisher's version https://doi.org/10.3390/vaccines10071105 Sí open Multidisciplinary Digital Publishing Institute |
| institution |
INIA ES |
| collection |
DSpace |
| country |
España |
| countrycode |
ES |
| component |
Bibliográfico |
| access |
En linea |
| databasecode |
dig-inia-es |
| tag |
biblioteca |
| region |
Europa del Sur |
| libraryname |
Biblioteca del INIA España |
| language |
English |
| topic |
Eulipotyphla Talpidae Antimicrobial peptide Insectivores Mammals Innate immunity Eulipotyphla Talpidae Antimicrobial peptide Insectivores Mammals Innate immunity |
| spellingShingle |
Eulipotyphla Talpidae Antimicrobial peptide Insectivores Mammals Innate immunity Eulipotyphla Talpidae Antimicrobial peptide Insectivores Mammals Innate immunity Otazo-Pérez, Andrea Asensio-Calavia, Patricia González-Acosta, Sergio Baca-González, Victoria López, Manuel R. Morales-De la Nuez, Antonio Pérez de Lastra, José Manuel Antimicrobial Activity of Cathelicidin-Derived Peptide from the Iberian Mole Talpa occidentalis |
| description |
19 Pág.
Centro de Biotecnología y Genómica de Plantas (CBGP) |
| author2 |
European Commission |
| author_facet |
European Commission Otazo-Pérez, Andrea Asensio-Calavia, Patricia González-Acosta, Sergio Baca-González, Victoria López, Manuel R. Morales-De la Nuez, Antonio Pérez de Lastra, José Manuel |
| format |
artículo |
| topic_facet |
Eulipotyphla Talpidae Antimicrobial peptide Insectivores Mammals Innate immunity |
| author |
Otazo-Pérez, Andrea Asensio-Calavia, Patricia González-Acosta, Sergio Baca-González, Victoria López, Manuel R. Morales-De la Nuez, Antonio Pérez de Lastra, José Manuel |
| author_sort |
Otazo-Pérez, Andrea |
| title |
Antimicrobial Activity of Cathelicidin-Derived Peptide from the Iberian Mole Talpa occidentalis |
| title_short |
Antimicrobial Activity of Cathelicidin-Derived Peptide from the Iberian Mole Talpa occidentalis |
| title_full |
Antimicrobial Activity of Cathelicidin-Derived Peptide from the Iberian Mole Talpa occidentalis |
| title_fullStr |
Antimicrobial Activity of Cathelicidin-Derived Peptide from the Iberian Mole Talpa occidentalis |
| title_full_unstemmed |
Antimicrobial Activity of Cathelicidin-Derived Peptide from the Iberian Mole Talpa occidentalis |
| title_sort |
antimicrobial activity of cathelicidin-derived peptide from the iberian mole talpa occidentalis |
| publisher |
Multidisciplinary Digital Publishing Institute |
| publishDate |
2022-07-10 |
| url |
http://hdl.handle.net/10261/278521 http://dx.doi.org/10.13039/501100000780 http://dx.doi.org/10.13039/501100007757 |
| work_keys_str_mv |
AT otazoperezandrea antimicrobialactivityofcathelicidinderivedpeptidefromtheiberianmoletalpaoccidentalis AT asensiocalaviapatricia antimicrobialactivityofcathelicidinderivedpeptidefromtheiberianmoletalpaoccidentalis AT gonzalezacostasergio antimicrobialactivityofcathelicidinderivedpeptidefromtheiberianmoletalpaoccidentalis AT bacagonzalezvictoria antimicrobialactivityofcathelicidinderivedpeptidefromtheiberianmoletalpaoccidentalis AT lopezmanuelr antimicrobialactivityofcathelicidinderivedpeptidefromtheiberianmoletalpaoccidentalis AT moralesdelanuezantonio antimicrobialactivityofcathelicidinderivedpeptidefromtheiberianmoletalpaoccidentalis AT perezdelastrajosemanuel antimicrobialactivityofcathelicidinderivedpeptidefromtheiberianmoletalpaoccidentalis |
| _version_ |
1767602912687554560 |